PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00434.1.g00370.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 568aa    MW: 60994.3 Da    PI: 7.9128
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00434.1.g00370.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.29e-28199248150
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                                   krien++nrqvtfskRrng++KKA+ELSvLCd++va+++fs++g+l  +s
  Zpz_sc00434.1.g00370.1.am.mk 199 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDIDVALLMFSPSGRLSHFS 248
                                   79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-37191250IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.324191251IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-26191251IPR002100Transcription factor, MADS-box
CDDcd002651.03E-32192248No hitNo description
PROSITE patternPS003500193247IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-24193213IPR002100Transcription factor, MADS-box
PfamPF003191.6E-25200247IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-24213228IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-24228249IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MQWRTLDSRP QVADDSFTGS QGQALSGLGT CALQPCRPSI TACLGMTSSS LLKLRSFLSP  60
ELLKRRAVGD HRRGNGEKER GGQPKSTKRP WPAARALCPE RLVQKSSGGP SPGRKRVHDV  120
VSIFSPPFPP LGPLRPVRCG SHTWWPRSCP SDPGRASASP SDAPSLSPPC RVVHRRVGRR  180
TCSRSSPIDA MGRVKLPIKR IENNTNRQVT FSKRRNGLIK KAYELSVLCD IDVALLMFSP  240
SGRLSHFSGR HGYPNESLAD VFRPRISRRA RVSDRFSALL AAVLACVAGW RTCMLQRLKR  300
EGDVATQLAK SVYELFEPAD LATLGSTSEI DGCEKFLTEV LARVVERKNY LLSSHMAPFD  360
ATATGVKDAA QMFVKPAEQV EGMAAFAGDV ALWAADEGSS PGHQMFGSSD PMIYLRYVPL  420
MSTTSIADQD MYGAPSQVAG LLGEPGAGGE ADADAWREEY TCTELLSTLI PATPFPLMQV  480
SIDPPFGSVA GGGGTTEHCL GLGPDDQFLP MDEEAMPMAV ATQEQVEASA SCSYVPRDET  540
GGTPPVMAYD STVAPEANVA GGSGTDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-15191248158Myocyte-specific enhancer factor 2B
1tqe_Q1e-15191248158Myocyte-specific enhancer factor 2B
1tqe_R1e-15191248158Myocyte-specific enhancer factor 2B
1tqe_S1e-15191248158Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047627e-67AP004762.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0686H11.
GenBankAP0051487e-67AP005148.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:B1142B04.
GenBankAP0149647e-67AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126167e-67CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankKF4693357e-67KF469335.1 Brachypodium distachyon MADS-box transcription factor 41 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649547.11e-109PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA0A0D9X9981e-116A0A0D9X998_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g38590.11e-103(Oryza sativa Japonica Group)
STRINGBGIOSGA026745-PA1e-103(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.12e-37AGAMOUS-like 66